Protein Info for ABID97_RS26475 in Variovorax sp. OAS795

Annotation: substrate-binding domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details TIGR03871: quinoprotein dehydrogenase-associated probable ABC transporter substrate-binding protein" amino acids 34 to 271 (238 residues), 293.2 bits, see alignment E=7.4e-92 PF00497: SBP_bac_3" amino acids 35 to 259 (225 residues), 29 bits, see alignment E=4.1e-11

Best Hits

KEGG orthology group: None (inferred from 81% identity to vap:Vapar_0699)

Predicted SEED Role

"Bll6196 protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (280 amino acids)

>ABID97_RS26475 substrate-binding domain-containing protein (Variovorax sp. OAS795)
MSSSCPTDLARAACAALLALLCAQEPVAAGMPAALRVCAEPDNLPYSREDQSGFENRIAR
LLADDLGLPLQYAWLPDRRGFVRKTLGANACDVVIGVPAGDERLLTTRPYYRSTYVFVQH
DTGATASRGLRSFDDARLPALRIGVQLVGNNLAATPPGHVLARHDAVRHVVGFTVAGEAP
PAQRMVDAVARGELDAAVVWGPQAGYFASRATPPLRITPAAAPADPDLPFAFSIAMGVRK
GDRAMKARLDDFIARRGADIDRILDDHAVPRMPLAQPEQP