Protein Info for ABID97_RS26460 in Variovorax sp. OAS795

Annotation: cytochrome c oxidase subunit I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 654 transmembrane" amino acids 52 to 72 (21 residues), see Phobius details amino acids 97 to 119 (23 residues), see Phobius details amino acids 131 to 152 (22 residues), see Phobius details amino acids 177 to 201 (25 residues), see Phobius details amino acids 215 to 237 (23 residues), see Phobius details amino acids 275 to 294 (20 residues), see Phobius details amino acids 301 to 322 (22 residues), see Phobius details amino acids 335 to 358 (24 residues), see Phobius details amino acids 369 to 390 (22 residues), see Phobius details amino acids 406 to 428 (23 residues), see Phobius details amino acids 443 to 463 (21 residues), see Phobius details amino acids 483 to 504 (22 residues), see Phobius details amino acids 598 to 615 (18 residues), see Phobius details amino acids 621 to 639 (19 residues), see Phobius details TIGR02891: cytochrome c oxidase, subunit I" amino acids 39 to 544 (506 residues), 714 bits, see alignment E=5e-219 PF00115: COX1" amino acids 48 to 493 (446 residues), 511.2 bits, see alignment E=1.2e-157

Best Hits

Swiss-Prot: 45% identical to COX1_BACSU: Cytochrome c oxidase subunit 1 (ctaD) from Bacillus subtilis (strain 168)

KEGG orthology group: K02274, cytochrome c oxidase subunit I [EC: 1.9.3.1] (inferred from 91% identity to vap:Vapar_0696)

MetaCyc: 45% identical to cytochrome caa3 oxidase (subunit I) (Bacillus subtilis subtilis 168)
CYTOCHROME-C-OXIDASE-RXN [EC: 7.1.1.9]

Predicted SEED Role

"Cytochrome c oxidase polypeptide I (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1 or 7.1.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (654 amino acids)

>ABID97_RS26460 cytochrome c oxidase subunit I (Variovorax sp. OAS795)
MDQPRHAPASRLKDGPGPGSREAAALDATWRDPPGVMGWLSAVNHKAIARRFIVTTFGFF
VAGGLLAFVMRLQLARPGSTLVGPDLYNQLFTMHGSTMMFLFAVPVMQAVTIYLLPLMLG
TRSVAFPRLNAFAYWIFLFGGLMLYVVFFLGAGPDVGWFSYVPLAGPDFSPGKRTDFWAQ
MITFTELSALVEAIVVITTVFKLRAPGMTLNRIPLFAWAMLVTAFMILFAMPSVMLASTT
LITDRLVGTHFYNPAEGGDAVLWQHLFWFFGHPEVYLIFLPGLGFISAIIPTFARRPMFG
YTAMVLALIATAFLAFGLWVHHMFAVNLPELGKSFFTAASMLIAIPSAVQIFCWIATLWS
GRLDFKTPLLFVLGFFFILVLGGMTGIMLASVPLDLQVHDSYFVVAHLHYVLIGGAVFPL
FGAFYYWYPKVTGRLMSERLGRWNFWLFFIGFNVAFFPMHLLGLRGMPRRVYTYQAGLGW
DTLNLVATVGAVVIAVSVLLFMVNAVRSLRRGAMAGANPWGAGTLEWATESPPPPCNFHA
IPVVHGREPLWEAPRAEAQRSSPAFTHVGGLAADTRELLATTVLDARPDLRVNFPDPTIW
PFVSAVAVTGLFIGSVFTPWAVVWGSIPIAIALTAWFWPRRSETAVHLSLERKP