Protein Info for ABID97_RS26340 in Variovorax sp. OAS795

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 signal peptide" amino acids 1 to 38 (38 residues), see Phobius details transmembrane" amino acids 71 to 92 (22 residues), see Phobius details amino acids 99 to 124 (26 residues), see Phobius details amino acids 130 to 153 (24 residues), see Phobius details amino acids 186 to 205 (20 residues), see Phobius details amino acids 225 to 244 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 82 to 251 (170 residues), 100.7 bits, see alignment E=4.3e-33

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 53% identity to bpy:Bphyt_1488)

Predicted SEED Role

"Hydroxymethylpyrimidine ABC transporter, transmembrane component" in subsystem Thiamin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (256 amino acids)

>ABID97_RS26340 ABC transporter permease (Variovorax sp. OAS795)
MHPAPSSRAESWRRFTDPALLFLALGLLWEKSVDVFGIKRYLLPPLSQVLDSLWTNRMTL
LVQSWFTTQEVLAGFALAAVGGVLLGLAIHAIPVVRRSLYPLIVVFQGLPKIALAPLMVI
WFGYGDTSKVLMAFLFAFFPVVIATMGGLAGTPAHLVEHFRAIRASSWTTFRRLYVPSAL
PSIMDGLRSAMPLAVIGAIVGEFVGSERGLGHLILEANANARTDYLFAALVVISVVAGLL
YLLVELAAKRIWWRGL