Protein Info for ABID97_RS26315 in Variovorax sp. OAS795
Annotation: malonic semialdehyde reductase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 61% identical to Y1586_CUPNJ: Putative NADH dehydrogenase/NAD(P)H nitroreductase Reut_A1586 (Reut_A1586) from Cupriavidus necator (strain JMP 134 / LMG 1197)
KEGG orthology group: K09019, putative NADH dehydrogenase/NAD(P)H nitroreductase RutE [EC: 1.-.-.-] (inferred from 61% identity to reu:Reut_A1586)MetaCyc: 60% identical to FAD reductase (NADH) (Cupriavidus nantongensis)
RXN-8506 [EC: 1.5.1.37]
Predicted SEED Role
"Predicted reductase RutE in novel pyrimidine catabolism pathway" in subsystem Pyrimidine utilization
KEGG Metabolic Maps
- Alkaloid biosynthesis I
- Carotenoid biosynthesis - General
- Insect hormone biosynthesis
- Nucleotide sugars metabolism
- Porphyrin and chlorophyll metabolism
- Puromycin biosynthesis
- Trinitrotoluene degradation
- alpha-Linolenic acid metabolism
Isozymes
Compare fitness of predicted isozymes for: 1.-.-.-
Use Curated BLAST to search for 1.-.-.- or 1.5.1.37
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (196 amino acids)
>ABID97_RS26315 malonic semialdehyde reductase (Variovorax sp. OAS795) MIPDSALDTLFRQARSHNGWLPRPVSEAQLRQIYELVKWGPTSANCSPMRVVFVRSDEGR ERLRPLLSPGNVEKTMTAPVTAILAFDTAFYRELPRLFPHRPGMQADFIGPDKEQHALRT AFRNASLQAGYFMLAARAIGLDCGPMSGFDVAGMDAAFWQGTSVRTNFLCNLGHGDPAHL FDRHPRLAFEEACRFA