Protein Info for ABID97_RS26315 in Variovorax sp. OAS795

Annotation: malonic semialdehyde reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 196 PF00881: Nitroreductase" amino acids 12 to 153 (142 residues), 49.9 bits, see alignment E=2.2e-17

Best Hits

Swiss-Prot: 61% identical to Y1586_CUPNJ: Putative NADH dehydrogenase/NAD(P)H nitroreductase Reut_A1586 (Reut_A1586) from Cupriavidus necator (strain JMP 134 / LMG 1197)

KEGG orthology group: K09019, putative NADH dehydrogenase/NAD(P)H nitroreductase RutE [EC: 1.-.-.-] (inferred from 61% identity to reu:Reut_A1586)

MetaCyc: 60% identical to FAD reductase (NADH) (Cupriavidus nantongensis)
RXN-8506 [EC: 1.5.1.37]

Predicted SEED Role

"Predicted reductase RutE in novel pyrimidine catabolism pathway" in subsystem Pyrimidine utilization

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.- or 1.5.1.37

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (196 amino acids)

>ABID97_RS26315 malonic semialdehyde reductase (Variovorax sp. OAS795)
MIPDSALDTLFRQARSHNGWLPRPVSEAQLRQIYELVKWGPTSANCSPMRVVFVRSDEGR
ERLRPLLSPGNVEKTMTAPVTAILAFDTAFYRELPRLFPHRPGMQADFIGPDKEQHALRT
AFRNASLQAGYFMLAARAIGLDCGPMSGFDVAGMDAAFWQGTSVRTNFLCNLGHGDPAHL
FDRHPRLAFEEACRFA