Protein Info for ABID97_RS26240 in Variovorax sp. OAS795

Annotation: SDR family NAD(P)-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 PF00106: adh_short" amino acids 61 to 257 (197 residues), 96.2 bits, see alignment E=3.8e-31 PF01370: Epimerase" amino acids 62 to 235 (174 residues), 26.4 bits, see alignment E=9.1e-10 PF08659: KR" amino acids 62 to 196 (135 residues), 27.5 bits, see alignment E=5.6e-10 PF13561: adh_short_C2" amino acids 65 to 261 (197 residues), 66.1 bits, see alignment E=7.7e-22

Best Hits

Swiss-Prot: 52% identical to OXIR_STRLI: Probable oxidoreductase from Streptomyces lividans

KEGG orthology group: None (inferred from 63% identity to npu:Npun_R1994)

Predicted SEED Role

"Short-chain dehydrogenase/reductase SDR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (336 amino acids)

>ABID97_RS26240 SDR family NAD(P)-dependent oxidoreductase (Variovorax sp. OAS795)
MSGGSSRDPVEEAGLESFPASDPPAWGLGTREGTARISTPFDFASTADEVLSGVRLSGRR
AIVTGATSGIGIETARALAHAGADVTLAVRDVEAGKKVAHAIAAARRCRVHVALLELSSP
RSVRDFVEEWRGPLHILVNNAGIMALPELQRSTEGWELQFATNFMGHMGLTVGLHDALAA
ANGARIVSLGSSGSLFSPVNFDDLHFNFIPYTPFVAYGQSKTACILLAMEANRRWSGEGI
FANALNPGAIATNLQKHSGGLKTPKERQKSVQQGAATSVLLAASPLLSGVGGRYFEDCNE
AEIVPVRSADYRGVAPYALDATNAHRLWEIAACLLH