Protein Info for ABID97_RS26145 in Variovorax sp. OAS795

Annotation: RidA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 132 PF01042: Ribonuc_L-PSP" amino acids 11 to 128 (118 residues), 99.8 bits, see alignment E=5.5e-33

Best Hits

Swiss-Prot: 32% identical to HMF1_YEAST: Protein HMF1 (HMF1) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

KEGG orthology group: None (inferred from 66% identity to pgv:SL003B_1296)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (132 amino acids)

>ABID97_RS26145 RidA family protein (Variovorax sp. OAS795)
MSPIFHMITGAPDPVAPFSHAVESDGWVFVTGQMPFAGTTLDSPYPEGIEAQTRQVLKNL
QTVLAGCGLGLEHALSVRVYLRHFEEDYAAMNAVYAEHFASGRRPARTCIGVTGLAKGAR
IEVDLVARRGAA