Protein Info for ABID97_RS26085 in Variovorax sp. OAS795

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 46 to 65 (20 residues), see Phobius details amino acids 78 to 101 (24 residues), see Phobius details amino acids 116 to 135 (20 residues), see Phobius details PF06580: His_kinase" amino acids 158 to 236 (79 residues), 72.8 bits, see alignment E=2.3e-24 PF02518: HATPase_c" amino acids 255 to 353 (99 residues), 27.5 bits, see alignment E=3.6e-10

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (354 amino acids)

>ABID97_RS26085 histidine kinase (Variovorax sp. OAS795)
MISVDSSIPARWLGAARLTAGSFLLCAIAAVLLFWAAPALGTLSRLFVFIECVGMVFIAC
VAVLGRSRRLMRMQALPRWLLTGAIAIPAGYFGGHMVALLILDEPVGGVVGHGTDYMVAF
AFGLVLAAFVLYVAATRDQLAKEAVARSDAQRLATESELRLLRAQLEPHMLFNTLANLRS
LVDEDPRQAERMIDQLIVYLRSTHAASRDEATTLKSEFSQLRAYLDIMSLRMGPRLAYRL
DLPAELERIAIPPMLLQPLVENAIKHGLEPKLGAGSIEVLARSIEGRIEVSIDDTGLGLS
PHPPAWRGDDAGTVCGSGLENVRDRLQALYGLRASLTLQARSPCGVRAVVRIPS