Protein Info for ABID97_RS25945 in Variovorax sp. OAS795

Annotation: carboxylesterase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 578 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details PF00135: COesterase" amino acids 61 to 543 (483 residues), 264.5 bits, see alignment E=4.7e-82 PF20434: BD-FAE" amino acids 147 to 260 (114 residues), 45.5 bits, see alignment E=1.4e-15 PF00326: Peptidase_S9" amino acids 178 to 260 (83 residues), 26.2 bits, see alignment E=1.1e-09 PF07859: Abhydrolase_3" amino acids 217 to 305 (89 residues), 27.3 bits, see alignment E=6.1e-10

Best Hits

KEGG orthology group: K03927, carboxylesterase type B [EC: 3.1.1.1] (inferred from 55% identity to vap:Vapar_5662)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.1

Use Curated BLAST to search for 3.1.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (578 amino acids)

>ABID97_RS25945 carboxylesterase family protein (Variovorax sp. OAS795)
MQEDALRAAATRRRFLLSGAALASASLVGCGGGGGSGASGIGIVGGAGGTVGTGAGGDDS
LVASTASGRYRGRQQDGVASWLGIPYAQPPVGPLRFQAPRPVQPVTGIVDAAAFGAASLQ
TVGGMVSWIYPTPELQSEDCLTLNVWSPSGAQRLPVIVWFHGGGFRTGATGMPLMNGKLL
AQRGVVVVTANYRLGALGLLSHPDFADAGNGATANWQLQDMDAALRWVRDNIGAFGGDPA
RVCVVGQSGGAMHTAMLAQNPAYRGTFQKAVLLSPPNVAPPASLTVTDAAAYTELLATKL
GTTPRGLRDVPAKALHDAELAQNAAPLPAGFASGASPYKLAPLIDGKTYLGDWTRRDWPA
DLPVVIDYTLDEGAFWWDLYDPASNSMLTPTPPGTLPAVGAALVAQLGGRTDAANTVIDV
YVQAALAEGRPTTPSLLWTDIFGDQLLRNFGTRYAARLSAAGVPVRLGTYMHAVKAPGRG
VPHCADVPMLFGTYGLNYYRDKLGATPQEAQLSNQFMAAMVSFASEAQPRLGTGEAWPLY
RPGTATSVRWGEGATGDTVLGAVPKLDQLKVWDAVLGY