Protein Info for ABID97_RS25895 in Variovorax sp. OAS795

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 34 to 55 (22 residues), see Phobius details amino acids 100 to 126 (27 residues), see Phobius details amino acids 149 to 173 (25 residues), see Phobius details amino acids 224 to 244 (21 residues), see Phobius details amino acids 262 to 287 (26 residues), see Phobius details PF00528: BPD_transp_1" amino acids 116 to 290 (175 residues), 90.6 bits, see alignment E=5.5e-30

Best Hits

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 93% identity to vap:Vapar_5636)

Predicted SEED Role

"Dipeptide transport system permease protein dppC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (301 amino acids)

>ABID97_RS25895 ABC transporter permease (Variovorax sp. OAS795)
METSTSPTAVSATALLAPAPPERRGGPLRWLASFGPSGLIGLAVLVFWLLAALLGPWLTS
QGMAAAGTSNVFEPISAKHWLGTDYLGRDMLALIIEGARYTIGVALLATLLASGTGTVLA
LLAAASGRWIDAVLSRGLDTLTAIPSKMFALIMVAGFGSSVPMLVVTAGIIYVPGAYRMA
RSLAVNINALDYVTVARTRGEGTLYIMLREILPNILGPMLADLGLRFVYVVLLLASLSFL
GLGIQPPAADWGSLVRENIGALAMGGASVIVPALAIASLTIAVNLVIDNLPGRAARERGA
R