Protein Info for ABID97_RS25840 in Variovorax sp. OAS795

Annotation: carbohydrate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 transmembrane" amino acids 32 to 51 (20 residues), see Phobius details amino acids 91 to 116 (26 residues), see Phobius details amino acids 126 to 150 (25 residues), see Phobius details amino acids 162 to 182 (21 residues), see Phobius details amino acids 203 to 225 (23 residues), see Phobius details amino acids 261 to 282 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 107 to 281 (175 residues), 75.3 bits, see alignment E=2.7e-25

Best Hits

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 96% identity to vap:Vapar_6267)

Predicted SEED Role

"binding-protein-dependent transport systems inner membrane component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (296 amino acids)

>ABID97_RS25840 carbohydrate ABC transporter permease (Variovorax sp. OAS795)
MTSASPALHPPAAAEHRESPASALSRMLRNGGLMAAVVLYTLYSALPFVWIGTMSVRTTS
EISANHFAWPETFHWEKFRIAWVDSNFAQYFWNSTLIVVSAVAIVTLLGAAAAHCLARYN
FRGNRLVYFILFSSIVFPPQIILISLFQVLVEYNLYNSRLGLMIVYVSLQLPLTVYLLEG
FFARIPQDLFDAAKMDGYSDFEIFWRIVLPVGMPAIATTIILNFIQLWNEFLFAVVLLSD
QGARTLPIGIRAYMGDYFQDIGMIATGMMIAVIPVVVLYAFFSEKLIQGMTAGAVK