Protein Info for ABID97_RS25775 in Variovorax sp. OAS795

Annotation: NAD-dependent epimerase/dehydratase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04321: RmlD_sub_bind
  • amino acids 6 to 163 (158 residues), 51.8 bits, E=1.6e-17
• PF01370: Epimerase
  • amino acids 7 to 242 (236 residues), 106.7 bits, E=3.3e-34
• PF16363: GDP_Man_Dehyd
  • amino acids 8 to 165 (158 residues), 63.2 bits, E=7.5e-21
• PF07993: NAD_binding_4
  • amino acids 67 to 216 (150 residues), 21.6 bits, E=2.7e-08

Best Hits

Swiss-Prot: 48% identical to Y2450_STAHJ: Uncharacterized epimerase/dehydratase SH2450 (SH2450) from Staphylococcus haemolyticus (strain JCSC1435)

KEGG orthology group: None (inferred from 77% identity to pol:Bpro_4367)

Predicted SEED Role

"L-threonine 3-dehydrogenase (EC 1.1.1.103)" in subsystem Glycine Biosynthesis or Threonine degradation (EC 1.1.1.103)

MetaCyc Pathways

• superpathway of L-threonine metabolism (15/18 steps found)
• L-threonine degradation II (2/2 steps found)
• L-threonine degradation III (to methylglyoxal) (2/3 steps found)
• aminopropanol phosphate biosynthesis II (2/4 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.103

Protein Sequence (328 amino acids)

>ABID97_RS25775 NAD-dependent epimerase/dehydratase family protein (Variovorax sp. OAS795)
MSGAPRILVIGANGQLGSELSAALAERYGADNVVGSDRVEVGRNAKLRHEMLDATDAGQL
AQVVEKHRITQIYHLAAALSATGETAPEWAWRLNMGSLLNVLEIARHRKLDKVFWPSSIA
AFGPTTPAVATPQQTVMEPSTIYGISKLAGEGWCRWYHENHGVDVRGLRYPGLISYKVSP
GGGTTDYAIDIFHAALKGERYTCFLAEDEPLPMLYMDDAVRGTLELMEAPAKAITERGSY
NLAGVSFTPREIAQEIRKHLPGFEIAYEPDFRQAIASGWPDSIDDSCARRDWNWAPRYDL
VATVRDMLKNLSPKSMPGVANGEHAAAN