Protein Info for ABID97_RS25775 in Variovorax sp. OAS795

Annotation: NAD-dependent epimerase/dehydratase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 PF04321: RmlD_sub_bind" amino acids 6 to 163 (158 residues), 51.8 bits, see alignment E=1.6e-17 PF01370: Epimerase" amino acids 7 to 242 (236 residues), 106.7 bits, see alignment E=3.3e-34 PF16363: GDP_Man_Dehyd" amino acids 8 to 165 (158 residues), 63.2 bits, see alignment E=7.5e-21 PF07993: NAD_binding_4" amino acids 67 to 216 (150 residues), 21.6 bits, see alignment E=2.7e-08

Best Hits

Swiss-Prot: 48% identical to Y2450_STAHJ: Uncharacterized epimerase/dehydratase SH2450 (SH2450) from Staphylococcus haemolyticus (strain JCSC1435)

KEGG orthology group: None (inferred from 77% identity to pol:Bpro_4367)

Predicted SEED Role

"L-threonine 3-dehydrogenase (EC 1.1.1.103)" in subsystem Glycine Biosynthesis or Threonine degradation (EC 1.1.1.103)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.103

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (328 amino acids)

>ABID97_RS25775 NAD-dependent epimerase/dehydratase family protein (Variovorax sp. OAS795)
MSGAPRILVIGANGQLGSELSAALAERYGADNVVGSDRVEVGRNAKLRHEMLDATDAGQL
AQVVEKHRITQIYHLAAALSATGETAPEWAWRLNMGSLLNVLEIARHRKLDKVFWPSSIA
AFGPTTPAVATPQQTVMEPSTIYGISKLAGEGWCRWYHENHGVDVRGLRYPGLISYKVSP
GGGTTDYAIDIFHAALKGERYTCFLAEDEPLPMLYMDDAVRGTLELMEAPAKAITERGSY
NLAGVSFTPREIAQEIRKHLPGFEIAYEPDFRQAIASGWPDSIDDSCARRDWNWAPRYDL
VATVRDMLKNLSPKSMPGVANGEHAAAN