Protein Info for ABID97_RS25735 in Variovorax sp. OAS795

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 transmembrane" amino acids 31 to 53 (23 residues), see Phobius details amino acids 95 to 120 (26 residues), see Phobius details amino acids 132 to 152 (21 residues), see Phobius details amino acids 158 to 175 (18 residues), see Phobius details amino acids 210 to 234 (25 residues), see Phobius details amino acids 260 to 282 (23 residues), see Phobius details PF12911: OppC_N" amino acids 22 to 69 (48 residues), 44 bits, see alignment 1.7e-15 PF00528: BPD_transp_1" amino acids 111 to 294 (184 residues), 95.9 bits, see alignment E=2.6e-31

Best Hits

Swiss-Prot: 40% identical to DPPC_BACPE: Dipeptide transport system permease protein DppC (dppC) from Bacillus pseudofirmus (strain OF4)

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 65% identity to bja:bll6712)

MetaCyc: 39% identical to murein tripeptide ABC transporter / oligopeptide ABC transporter inner membrane subunit OppC (Escherichia coli K-12 substr. MG1655)
3.6.3.23-RXN [EC: 7.4.2.6]; 7.4.2.6 [EC: 7.4.2.6]

Predicted SEED Role

"Oligopeptide transport system permease protein OppC (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (295 amino acids)

>ABID97_RS25735 ABC transporter permease (Variovorax sp. OAS795)
MSTVQTATLVPPRRTLAERFPALRRFLRHRAALLGVGIVLFMTLLSFVGPLLMPFNATDT
DIRARLAEPFAGPHLLGTDPLGRDVLARLMYAGRISLAVGFAATALSVVVGVLVGLVAGF
YRGAIGAALMRFVDAMLCFPTIFLLLAVAALIEPSVTSIVVLIALASWMEVARVVEGQIR
SLRERDFALAAESLGASDSRIMFRELLPNAVAPIVVAATLNIAHAILAESYISFLGFGIQ
PPTPSWGNMLENAQSYLTNAPWLAIVPGLAITLTVTSFNFIGDGLRDALDAKLDR