Protein Info for ABID97_RS25730 in Variovorax sp. OAS795

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 102 to 123 (22 residues), see Phobius details amino acids 135 to 157 (23 residues), see Phobius details amino acids 180 to 199 (20 residues), see Phobius details amino acids 237 to 261 (25 residues), see Phobius details amino acids 283 to 308 (26 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 1 to 77 (77 residues), 37.9 bits, see alignment E=1.9e-13 PF00528: BPD_transp_1" amino acids 114 to 314 (201 residues), 142.5 bits, see alignment E=1.3e-45

Best Hits

Swiss-Prot: 48% identical to APPB_BACSU: Oligopeptide transport system permease protein AppB (appB) from Bacillus subtilis (strain 168)

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 68% identity to bja:bll6713)

Predicted SEED Role

"Oligopeptide transport system permease protein OppB (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (318 amino acids)

>ABID97_RS25730 ABC transporter permease (Variovorax sp. OAS795)
MARYLLRRLLQSLLLLALVSVIAFAILHLAPGGPLAQFVATGDLGTEDVDRLMKQYGLDR
PVPIQYLDWAGSIATGDWGKSYRDQLPVLKKIGMHVGPTLELMVSSTLLAMFIGGMIGIL
GAVRRYSIFDHLATIGAMVALSIPTFWFGLAVIYVFSVNLGWLPAGNRETIGDGSFIDRL
QHLVAPCIVLALVSTAVWSRYMRSSMLDVVNQDYIRTAKSKGVPAMQILLRHALRNALLP
MITITGLHVSTLLSGALVTETVFTWPGMGRLFLDSVSNRDYPVVMGMLMFTACMVLLGSL
VADLLYSVADPRIKGASK