Protein Info for ABID97_RS25540 in Variovorax sp. OAS795

Annotation: sugar ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 519 PF00005: ABC_tran" amino acids 23 to 174 (152 residues), 95.8 bits, see alignment E=3.5e-31 amino acids 274 to 430 (157 residues), 48.8 bits, see alignment E=1.1e-16

Best Hits

Swiss-Prot: 41% identical to RBSA1_STRAW: Ribose import ATP-binding protein RbsA 1 (rbsA1) from Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)

KEGG orthology group: None (inferred from 57% identity to mci:Mesci_5302)

Predicted SEED Role

"Ribose ABC transport system, ATP-binding protein RbsA (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (519 amino acids)

>ABID97_RS25540 sugar ABC transporter ATP-binding protein (Variovorax sp. OAS795)
MSQPTQAISVEQVRKAFGPTVALESVTYSIAAGKVHALLGENGAGKSTSVKILSGLVRPD
SGVIRLFGDEVRMNSPRDAHRLGVQTAFQELTLIPDLSVAENLLLPYQPTGLGGLLNKKA
AEERVAESLAKMGLHMISPRAEVRSLDLPLRQKIEIAKAALREPKVLLLDEPTSALSGED
IAWLGQIIAQQKARGTTIIFITHRMPEVRMFCDSLTILRNGCSVGTFGIDEISDEEVIEQ
IIGRSLEKTFPPKPPVDRSAPPVLAVRELSAGRLRNASLSLQPGEVLGVAGLAGMGQLEL
FLSLFGDVPACAGTITVDGREVKIESPRDAIDARLGITLVPEERKTEALFLRLDGRQNTA
LPVLDRYTRFGLIDSEAEGLAVAGALAKVQVAERALHMPASAFSGGNQQKIVMAKWLLAG
GRVLLLFDPTRGVDVGTKHEIYLLINEYVRAGGSVILYSTEIEEVVHLSHRVVVFYGGSI
VREIDGAVEAISESEIMRAALGSAHTHGAETATRKAVQS