Protein Info for ABID97_RS25280 in Variovorax sp. OAS795

Annotation: phosphatase PAP2 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 272 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 59 to 81 (23 residues), see Phobius details amino acids 113 to 137 (25 residues), see Phobius details amino acids 144 to 162 (19 residues), see Phobius details amino acids 186 to 205 (20 residues), see Phobius details amino acids 215 to 236 (22 residues), see Phobius details amino acids 242 to 263 (22 residues), see Phobius details PF01569: PAP2" amino acids 144 to 260 (117 residues), 64.3 bits, see alignment E=4.8e-22

Best Hits

KEGG orthology group: None (inferred from 88% identity to vap:Vapar_4747)

Predicted SEED Role

"Phosphatidylglycerophosphatase B (EC 3.1.3.27)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 3.1.3.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.27

Use Curated BLAST to search for 3.1.3.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (272 amino acids)

>ABID97_RS25280 phosphatase PAP2 family protein (Variovorax sp. OAS795)
MSTQAPALVLLARGLGEHSLAWFACALGLSVLGAGLVCRTWQQRRARTSPTGEPEEPRLA
AALAMGFLAILGAASLVAYIASKLGDGRLLGLADQALADAIGDHVPWAALVAFSWLTHLG
DAELLAPVCLAVAVLLWRKAHHGLALGWMMALGGIVLLNPALKRIFARARPVHDHGLALE
TSFSFPSGHSAGAIVSYGMLMYLALRLLPARWHVPAAMAAAAAIVTIASSRVFLQVHFAS
DVAAGLLTGLAWLLVCVGSLEYARHRRRRAAR