Protein Info for ABID97_RS25170 in Variovorax sp. OAS795

Annotation: leucine-rich repeat-containing protein kinase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 PF00560: LRR_1" amino acids 37 to 58 (22 residues), 12.2 bits, see alignment (E = 5.7e-05) PF13855: LRR_8" amino acids 90 to 140 (51 residues), 28 bits, see alignment 4.6e-10 PF07714: PK_Tyr_Ser-Thr" amino acids 209 to 364 (156 residues), 39.2 bits, see alignment E=1.6e-13 PF00069: Pkinase" amino acids 211 to 364 (154 residues), 38.5 bits, see alignment E=2.8e-13 PF06293: Kdo" amino acids 294 to 354 (61 residues), 32.1 bits, see alignment E=2.4e-11

Best Hits

KEGG orthology group: None (inferred from 87% identity to vap:Vapar_4737)

Predicted SEED Role

"serine/threonine protein kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (436 amino acids)

>ABID97_RS25170 leucine-rich repeat-containing protein kinase family protein (Variovorax sp. OAS795)
MDTLAELRAGRLAGAKRLDLSCGLTEFPREIFGLADSLETLNLSGNALDSLPDDMGRLHR
LRVLFCSDNRFTRLPESIGDCQALEMVGFKANRIGTVPDAALRLPVLRWLILTDNKIETL
PETLGHCTAMQKLMLAGNRLRALPASLAACGQLELLRISANRFEALPPWLLSLPRLSWLA
GAGNPFDAQAEDAAMAAQSVPRVDWRELTLGVQLGEGASGVIHQATLGPAGQPVAVKLFK
GAVTSDGWPHSEMAASIAAGAHPTLVAAQGRIEGHPGGTEGLVMALVDPSFRALAGPPSL
ASCTRDVYAADAQWTSGVALRIARDIASAMRHLHARGILHGDLYAHNILWNAQGGGLLGD
FGAAWMTGALDPAQAGALQRLEMRAFGCLLEELLARCSDTPPLAMAALKDRCMQPDVAAR
PVFDDALSLLQDALGQ