Protein Info for ABID97_RS24965 in Variovorax sp. OAS795

Annotation: peptidoglycan DD-metalloendopeptidase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 transmembrane" amino acids 27 to 46 (20 residues), see Phobius details PF19425: Csd3_N2" amino acids 182 to 298 (117 residues), 30.5 bits, see alignment E=3e-11 PF01551: Peptidase_M23" amino acids 311 to 405 (95 residues), 125.6 bits, see alignment E=7.4e-41

Best Hits

KEGG orthology group: None (inferred from 95% identity to vap:Vapar_4673)

Predicted SEED Role

"Peptidase, M23/M37 family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (447 amino acids)

>ABID97_RS24965 peptidoglycan DD-metalloendopeptidase family protein (Variovorax sp. OAS795)
MINGILAAEELLASRVAYTFRTYPKQITAAIAAALLSAGTLAVASLGPDASDLPVQQVLE
ATAPLSFAEQSESLENFSFTLFRTDITRSSDTAEALLKRLGISDPAATAFVRGSGEARNA
LFARAGRTVTAEATQQNELKKLSARWIPDGDGGFKRFVIERTPAGFVALTERDTLTPGSR
LASGTIRTSLFAATDDARIPDAVASQLADIFAGDVDVRSLRKGDRFAVVYETFEADGQAL
RSGRVLSAEFESGGKVHQAVWFQPPGQQKGSYYRPNGDSLRKAYLSSPVEFSRVSSGFAM
RMHPILNSWRQHNGIDFAAPTGTAVRSVGDGTVDFAGTQNGYGNIVIIKHRNNQQTAYAH
LSRVDVKAGDSVSQGQTVGAVGSTGWATGPHLHFEFRVNGEYQDPTSIAQEGGAPITAAL
RPAFERIAVGARTELAAAFSVIQASAD