Protein Info for ABID97_RS24930 in Variovorax sp. OAS795

Annotation: rRNA maturation RNase YbeY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 153 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF02130: YbeY" amino acids 31 to 143 (113 residues), 99.9 bits, see alignment E=5.1e-33 TIGR00043: rRNA maturation RNase YbeY" amino acids 44 to 145 (102 residues), 102.2 bits, see alignment E=8.6e-34

Best Hits

Swiss-Prot: 78% identical to YBEY_ACIAC: Endoribonuclease YbeY (ybeY) from Acidovorax citrulli (strain AAC00-1)

KEGG orthology group: K07042, probable rRNA maturation factor (inferred from 94% identity to vap:Vapar_4667)

Predicted SEED Role

"Metal-dependent hydrolase YbeY, involved in rRNA and/or ribosome maturation and assembly"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (153 amino acids)

>ABID97_RS24930 rRNA maturation RNase YbeY (Variovorax sp. OAS795)
MALAQLSLSLQFAPRFKGIERHRAALPRHSVARWIRHALELDGEITVRIVDAEEGQRLNR
EFRGKDYATNVLTFDYAQSPMVMADLVLCAPVVASEAKEQRKTLAAHYAHLLVHGTLHAQ
GWDHETGEADAEEMEAREIEILAGLGIRNPYGR