Protein Info for ABID97_RS24920 in Variovorax sp. OAS795

Annotation: Holliday junction branch migration protein RuvA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 190 TIGR00084: Holliday junction DNA helicase RuvA" amino acids 1 to 188 (188 residues), 187.1 bits, see alignment E=1.2e-59 PF01330: RuvA_N" amino acids 1 to 62 (62 residues), 83.9 bits, see alignment E=1.7e-27 PF14520: HHH_5" amino acids 72 to 129 (58 residues), 59.3 bits, see alignment E=1e-19 PF07499: RuvA_C" amino acids 145 to 189 (45 residues), 46.2 bits, see alignment 1.3e-15

Best Hits

Swiss-Prot: 98% identical to RUVA_VARPS: Holliday junction ATP-dependent DNA helicase RuvA (ruvA) from Variovorax paradoxus (strain S110)

KEGG orthology group: K03550, holliday junction DNA helicase RuvA (inferred from 98% identity to vap:Vapar_4665)

MetaCyc: 48% identical to Holliday junction branch migration complex subunit RuvA (Escherichia coli K-12 substr. MG1655)
3.1.22.4-RXN [EC: 3.1.21.10]

Predicted SEED Role

"Holliday junction DNA helicase RuvA" in subsystem DNA-replication or RuvABC plus a hypothetical

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.21.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (190 amino acids)

>ABID97_RS24920 Holliday junction branch migration protein RuvA (Variovorax sp. OAS795)
MIGKLTGILAERNPPQVVVDCNGVGYEVDVPMSTFYNLPGTGERVSLLTHFVVREDAQIL
YGFGTAEERAAFRQLIKITGVGPRTALGLLSGMSVGELAQAITTQELGRLVKIPGIGKKT
AERLLLELKGKLGADIGLPAHAASDAQADILQALVALGYSDKEAALALKALPKDATVSEG
IKLALKALAK