Protein Info for ABID97_RS24775 in Variovorax sp. OAS795

Annotation: ribokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 PF00294: PfkB" amino acids 16 to 305 (290 residues), 237 bits, see alignment E=3.1e-74 TIGR02152: ribokinase" amino acids 17 to 310 (294 residues), 324.3 bits, see alignment E=3.7e-101 PF08543: Phos_pyr_kin" amino acids 172 to 290 (119 residues), 34.6 bits, see alignment E=1.4e-12

Best Hits

KEGG orthology group: K00852, ribokinase [EC: 2.7.1.15] (inferred from 87% identity to vap:Vapar_4640)

Predicted SEED Role

"Ribokinase (EC 2.7.1.15)" in subsystem D-ribose utilization or Deoxyribose and Deoxynucleoside Catabolism (EC 2.7.1.15)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (322 amino acids)

>ABID97_RS24775 ribokinase (Variovorax sp. OAS795)
MSSQPSSSSVAQQPPRIVVLGSLNMDIVLRVPQAPSAGETLLGRSIAHIPGGKGANQAVS
CAREGGRVHMIGCVGNDANGQALRDALAQDGIDTAALRTDDAEPTGTALILVEDSGQNRI
VMIPGANAKVEIDEAALQHQLQGAAFLVAQFESPMDQVTLAITAAHGAGCKVLLNPSPVQ
PIAGPLWPCIDTLVVNEIEAHALCGQAVDSPHEAAAAGRALRAKGIARVVVTLGARGAVA
VDADGAHHHPAPKVKAVDTTAAGDTFLGALAVALGEGQSFDEAVRLGIRAAALCIQQPGA
QPSIPRRDAVLHSPLPPDWIAL