Protein Info for ABID97_RS24765 in Variovorax sp. OAS795

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 transmembrane" amino acids 25 to 47 (23 residues), see Phobius details amino acids 59 to 77 (19 residues), see Phobius details amino acids 83 to 100 (18 residues), see Phobius details amino acids 107 to 131 (25 residues), see Phobius details amino acids 168 to 192 (25 residues), see Phobius details amino acids 221 to 239 (19 residues), see Phobius details amino acids 251 to 271 (21 residues), see Phobius details amino acids 278 to 299 (22 residues), see Phobius details amino acids 305 to 321 (17 residues), see Phobius details PF02653: BPD_transp_2" amino acids 53 to 316 (264 residues), 156.5 bits, see alignment E=3.8e-50

Best Hits

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 97% identity to vap:Vapar_4638)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (331 amino acids)

>ABID97_RS24765 ABC transporter permease (Variovorax sp. OAS795)
MNAAAATTATTSAPPSALKGQLGTYLGLTVVLLGMVALFGALSEYFFTRETFISIANEIP
ALAVMAVGMTFVLIIAGIDLSVGSVLALSAAVTAAAILQWKLSVPAAAALGLATGLVCGT
VTGAVSVAWRLPSFIVSLGMLEAVRGGAYLVTDSRTQYVGDAISGLAAPWVGGISAAFVL
AVVLVAVGQLVLTRTVFGRHVVGIGTNEEAMRLAGIDPRPIRIIVFAATGLLAGLAGLMQ
SARLEAADPNAGVGIELQVIAAVVIGGTSLMGGRGSVVNTFFGVLIIAVLEAGLAQVGAS
EPSKRIITGAVIVVAVIIDTLRQRRADRRLA