Protein Info for ABID97_RS24690 in Variovorax sp. OAS795

Annotation: methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 771 transmembrane" amino acids 102 to 123 (22 residues), see Phobius details amino acids 386 to 411 (26 residues), see Phobius details PF13675: PilJ" amino acids 125 to 228 (104 residues), 71.4 bits, see alignment E=6.8e-24 amino acids 259 to 358 (100 residues), 41 bits, see alignment E=1.8e-14 PF00015: MCPsignal" amino acids 553 to 736 (184 residues), 136 bits, see alignment E=1.2e-43

Best Hits

KEGG orthology group: K02660, twitching motility protein PilJ (inferred from 94% identity to vap:Vapar_4623)

Predicted SEED Role

"twitching motility protein PilJ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (771 amino acids)

>ABID97_RS24690 methyl-accepting chemotaxis protein (Variovorax sp. OAS795)
MSSIADKFKKLLPPTSGNDKARVDGSGSTLSLDDVDTVQVPDEKTVRLARKQDDAPAPAG
FADGAPLVGEAANEADAASADAVQTQASTGRAGSSPARQQRILAIMLALVVLLLLLVAGS
AILRAERLAQQVAATGQSLMQSQRLAKSISQALVGSAPAFLEVKDSADDLSRRVQGLTNG
DDALRLERVGNQYDDDMAKINPLVARADASAKAVLAQRQILTQVGAALRDINQQSSALLE
MTETVASLKMQQNATLPEISAAGQLVMLTQRIGKSTNEFFTVEGVNPDAVFLLGKDLNTF
QETTRGLLDGNAQQRFPGSKDPQTRQQLEAILKTYEQMRTQASAILGNLQGLVAAREAQA
SILTDSEPLRKSLGELQDKLSARTGLGAGTIVMLFVLSLAALALAGAIGFVQVREGRERA
LVAERERLAAEQASDEAGRINNANQAAILRLMNELQTVAEGDLTQEATVTEDITGAIADS
VNYTVEELRLLVGNVQNTATRVAQTTSQVESTSTELLAASTEQLREIRETGQSVLTMAER
INGVSSQAQESATVARQSLQAASSGLQAVQNAIGGMNSIRDQIQETSKRIKRLGESSQEI
GEITELISDITEQTNVLALNAAIQAASAGEAGRGFSVVAEEVQRLAERSADATRQISALV
KAIQTDTQDAVGAMERSTQGVVEGAKLSDNAGTALTEIDRVSRRLADLIEQISQSASREA
DSANVVAANIQHIFAVTEQTGEGTRTTAQQVRELSQMAEELRRSVARFKIA