Protein Info for ABID97_RS24585 in Variovorax sp. OAS795

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 464 transmembrane" amino acids 29 to 52 (24 residues), see Phobius details amino acids 65 to 88 (24 residues), see Phobius details amino acids 95 to 115 (21 residues), see Phobius details amino acids 121 to 141 (21 residues), see Phobius details amino acids 153 to 174 (22 residues), see Phobius details amino acids 180 to 204 (25 residues), see Phobius details amino acids 265 to 285 (21 residues), see Phobius details amino acids 298 to 321 (24 residues), see Phobius details amino acids 328 to 348 (21 residues), see Phobius details amino acids 356 to 382 (27 residues), see Phobius details amino acids 394 to 413 (20 residues), see Phobius details amino acids 419 to 439 (21 residues), see Phobius details PF00083: Sugar_tr" amino acids 31 to 438 (408 residues), 90.8 bits, see alignment E=9.4e-30 PF07690: MFS_1" amino acids 35 to 297 (263 residues), 105.1 bits, see alignment E=3.8e-34 amino acids 268 to 442 (175 residues), 44.1 bits, see alignment E=1.3e-15

Best Hits

KEGG orthology group: K08195, MFS transporter, AAHS family, 4-hydroxybenzoate transporter (inferred from 79% identity to pfl:PFL_3477)

Predicted SEED Role

"4-hydroxybenzoate transporter" in subsystem Cinnamic Acid Degradation or Gentisare degradation or Phenylpropanoid compound degradation or Salicylate and gentisate catabolism or p-Hydroxybenzoate degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (464 amino acids)

>ABID97_RS24585 MFS transporter (Variovorax sp. OAS795)
MNTATAPFKGNADIGRLLDDGAYTTMQKVVVFLAALSIVMDGFDGQLIGFAIPSMIKEWG
ITRGAFVPAVAAGLVGMGIGSACAGLFADRFGRRMAVIASVFLFGTATCAIGFAPDVLTV
AVLRFIAGLGIGGALPSSTTVTAEFTPARRRTLAVTATIVCVPLGGMLAGLFAAEVLPAF
GWRGLFFIGGTFPMALAVLLLFTLPESPRFLARHPARWGELSRLLGRMGRPMAQDVTYTD
VAEQVVERRAGFSALFSNGLARDTLATWAAFFMCLTAVYTAFSWLPTMLASEGLSMAVAG
SGLTAYNLGGVIGALACAVAITRFGSRWPLVLCCAGAAASAFALQTLNVGKDTNLLIFGF
GVHGMFVNAVQSTMYALCAFMYPTSVRATGTASALAFGRLGAILSAFAGAAVITAGGAMA
YLALLGSAMFFAMVALLVVRRHIPGRDVLLPRHSRTTGGQTFHG