Protein Info for ABID97_RS24545 in Variovorax sp. OAS795

Annotation: branched-chain amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 transmembrane" amino acids 18 to 38 (21 residues), see Phobius details amino acids 44 to 63 (20 residues), see Phobius details amino acids 67 to 87 (21 residues), see Phobius details amino acids 95 to 117 (23 residues), see Phobius details amino acids 124 to 141 (18 residues), see Phobius details amino acids 168 to 188 (21 residues), see Phobius details amino acids 218 to 237 (20 residues), see Phobius details amino acids 254 to 280 (27 residues), see Phobius details amino acids 291 to 314 (24 residues), see Phobius details PF02653: BPD_transp_2" amino acids 44 to 291 (248 residues), 112.5 bits, see alignment E=1e-36

Best Hits

KEGG orthology group: None (inferred from 72% identity to bja:bll6403)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (333 amino acids)

>ABID97_RS24545 branched-chain amino acid ABC transporter permease (Variovorax sp. OAS795)
MNSVALMDGARRRKAGRAAVGFAVLVVLGALALAPWFTSFATQRLLVEIFTVFAMALAWN
LLAGYGGLVVVGHQMFVGVGAYALFALSNRLGINPWVMLPLAAASTALFALLSALPMFRL
SGAHFAVGTWVLAEMLRILTLNSEWLGAGGGMPLEALASFDRWTRNAGVYWSALITGVGA
LVIARLMLRGKLGLALMSVRDSEAAAAASGVSIQRAKLALWVIAGSITGLAGAVAYMNTL
QVTPDATFSLNWSAAAIFIAVLGGIGTLEGPILGTILYFLLRESFATYGSWYFIGLGSLA
IATMVFAPGGAWSLVTRRWAIDPFGVRRDMPRR