Protein Info for ABID97_RS24170 in Variovorax sp. OAS795

Annotation: ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 458 transmembrane" amino acids 32 to 55 (24 residues), see Phobius details amino acids 175 to 195 (21 residues), see Phobius details PF00672: HAMP" amino acids 195 to 243 (49 residues), 39.9 bits, see alignment 6.4e-14 PF00512: HisKA" amino acids 250 to 293 (44 residues), 28.6 bits, see alignment 1.8e-10 PF02518: HATPase_c" amino acids 349 to 450 (102 residues), 84.6 bits, see alignment E=1e-27

Best Hits

KEGG orthology group: None (inferred from 89% identity to vap:Vapar_4427)

Predicted SEED Role

"sensor histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (458 amino acids)

>ABID97_RS24170 ATP-binding protein (Variovorax sp. OAS795)
MSTPAIAPVNPSGAGGMGVGARGWRRLLPGSLFLRVTLIIVVGLAVAQLLTFAAIRYERN
LALRELMMTGIERDIASSVAILDRLPAAERAGWLDRLERRNYRFVLGGSAEGGEPGSEAS
RQFAKAITEAMRPFEIVKVGEVAWPPEGLQIQVRLGDGSSVVVHAMRVGMPVSGWVMWVL
AIQLLMLAVCAWVAVRLVTRPLAQLSAAADDLGPDLTARSLAEEGPTEVAHAARAFNAMQ
QRIAGYMAERVEILAAISHDLQTPITRMRLRTEMMDNAHDREKFRQDLDAMHSLVREGVT
YARTLHGATEPPLRIDADALLESLVADYEDVGQPVRLEGKAGAPIVSRPNALRRILMNLI
DNALKFGSDVRLCVHAEGGRLVLRVLDDGPGIPPDELDAVLKPFYRVESSRNRSTGGTGL
GLAIAHQLAMAMGAELTLHNRAEGGLEARLALAGAPAH