Protein Info for ABID97_RS24150 in Variovorax sp. OAS795

Annotation: alpha/beta hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF12146: Hydrolase_4" amino acids 69 to 180 (112 residues), 58.3 bits, see alignment E=2.6e-19 PF00561: Abhydrolase_1" amino acids 73 to 161 (89 residues), 40.7 bits, see alignment E=8e-14 PF12697: Abhydrolase_6" amino acids 74 to 174 (101 residues), 30.5 bits, see alignment E=2e-10 PF00326: Peptidase_S9" amino acids 92 to 273 (182 residues), 41.7 bits, see alignment E=3.4e-14 PF03959: FSH1" amino acids 124 to 257 (134 residues), 22.5 bits, see alignment E=2.9e-08

Best Hits

Swiss-Prot: 48% identical to YHFR_ECO57: Uncharacterized protein YfhR (yhfR) from Escherichia coli O157:H7

KEGG orthology group: K06889, (no description) (inferred from 83% identity to vpe:Varpa_5110)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (278 amino acids)

>ABID97_RS24150 alpha/beta hydrolase (Variovorax sp. OAS795)
MMNWKPALLALPLFLTGCVQSMFYYPDRVRYETPEALGLRYEAVQFQSADGTRLSGWFIP
AVNRQSPKEAKGTVVHFHGNAQNMSAHWRFVAWLPKQDFNVFVFDYRGYGQSEGKPGPKG
VFEDSNAALDHVRTRADVDPERLFVYGQSLGGTNAIAVVGSGNRAGVKAAAIEATFYSYS
AIASEKLPGAGLLVSDAYAASRYIGAISPIPLLLIHGTADPVIPHSHSRRLLDAAREPKR
LVEVAGAGHLEPMTERFGTTYQRALVDFFDASLRPRQP