Protein Info for ABID97_RS23960 in Variovorax sp. OAS795

Annotation: cytochrome c oxidase subunit I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 543 transmembrane" amino acids 42 to 62 (21 residues), see Phobius details amino acids 83 to 104 (22 residues), see Phobius details amino acids 125 to 148 (24 residues), see Phobius details amino acids 168 to 192 (25 residues), see Phobius details amino acids 204 to 230 (27 residues), see Phobius details amino acids 255 to 275 (21 residues), see Phobius details amino acids 287 to 310 (24 residues), see Phobius details amino acids 323 to 345 (23 residues), see Phobius details amino acids 358 to 381 (24 residues), see Phobius details amino acids 393 to 415 (23 residues), see Phobius details amino acids 434 to 454 (21 residues), see Phobius details amino acids 472 to 494 (23 residues), see Phobius details TIGR02891: cytochrome c oxidase, subunit I" amino acids 30 to 533 (504 residues), 700.9 bits, see alignment E=4.7e-215 PF00115: COX1" amino acids 38 to 479 (442 residues), 539.1 bits, see alignment E=4.1e-166

Best Hits

Swiss-Prot: 57% identical to COX1_RICCN: Probable cytochrome c oxidase subunit 1 (ctaD) from Rickettsia conorii (strain ATCC VR-613 / Malish 7)

KEGG orthology group: K02274, cytochrome c oxidase subunit I [EC: 1.9.3.1] (inferred from 98% identity to vap:Vapar_4391)

MetaCyc: 68% identical to cytochrome c oxidase subunit 1 (Pseudomonas putida KT2440)

Predicted SEED Role

"Cytochrome c oxidase polypeptide I (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (543 amino acids)

>ABID97_RS23960 cytochrome c oxidase subunit I (Variovorax sp. OAS795)
MSAVLDPHGHAHDGHAHDEHHAAPTGWRRWVFATNHKDIGTLYLLFSFTMLMVGGVLALM
IRAELFQPGLQLVNPELFNQFTTMHGLIMVFGAIMPAFVGFANWMIPLQIGASDMAFARM
NNFSFWLLIPAALMLVGSFFMPGGAPAAGWTLYAPLTLQMGPSMDAGIFAMHIMGASSIM
GSINIIVTILNMRAPGMTLMKMPMFCWTWLITAYLLIAVMPVLAGAITMTLTDRHFGTSF
FNPAGGGDPVMYQHIFWFFGHPEVYIMILPAFGIISQIVPAFSRKRLFGYASMVYATSSI
AILSFIVWAHHMFTTGMPVTGQLFFMYATMLIAVPTAVKIFNWIATMWQGSMTFETPMLF
AVGFIFVFTMGGFTGLILAIAPIDIQLQDTYYVVAHFHYVLVAGSLYAMFAGYYYWAPKW
TGVMYNESRGKLHFWWSLISFNVTFFPMHFLGLAGMPRRYADYPMQFADFNAVASIGAFA
FGLAQVYFFFFIVLPNMLGKGEKAPQKPWEAAEGLEWEVPSPAPFHTFENPPRLDPTATK
VIG