Protein Info for ABID97_RS23950 in Variovorax sp. OAS795

Annotation: cytochrome c oxidase assembly protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 transmembrane" amino acids 14 to 35 (22 residues), see Phobius details PF04442: CtaG_Cox11" amino acids 32 to 186 (155 residues), 169.5 bits, see alignment E=2.6e-54

Best Hits

KEGG orthology group: K02258, cytochrome c oxidase subunit XI assembly protein (inferred from 96% identity to vap:Vapar_4389)

Predicted SEED Role

"Cytochrome oxidase biogenesis protein Cox11-CtaG, copper delivery to Cox1" in subsystem Biogenesis of cytochrome c oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (208 amino acids)

>ABID97_RS23950 cytochrome c oxidase assembly protein (Variovorax sp. OAS795)
MSLGQRIKRANVRMVGKLAVVACGMFAFGYALVPLYRAICEMTGINILALSELEVPGGAS
GGKNVRLPDNTQVDTTRTITVEFDSNVRGGLWDFKPAERTMQVHPGQLNTVMYEFQNVQN
RRMAAQAIPSYAPQQAAPYFNKLECFCFNQYTLDPGEKKQWPVAFVIDPKISKDVKTITL
SYTFFEVGGKTPPAPVAAAPNAAHEPRS