Protein Info for ABID97_RS23920 in Variovorax sp. OAS795

Annotation: COX15/CtaA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 44 to 64 (21 residues), see Phobius details amino acids 118 to 137 (20 residues), see Phobius details amino acids 157 to 177 (21 residues), see Phobius details amino acids 181 to 205 (25 residues), see Phobius details amino acids 226 to 245 (20 residues), see Phobius details amino acids 298 to 318 (21 residues), see Phobius details amino acids 329 to 348 (20 residues), see Phobius details amino acids 354 to 374 (21 residues), see Phobius details PF02628: COX15-CtaA" amino acids 47 to 369 (323 residues), 248.5 bits, see alignment E=4.3e-78

Best Hits

KEGG orthology group: K02259, cytochrome c oxidase subunit XV assembly protein (inferred from 90% identity to vap:Vapar_4383)

Predicted SEED Role

"Heme A synthase, cytochrome oxidase biogenesis protein Cox15-CtaA" in subsystem Biogenesis of cytochrome c oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (406 amino acids)

>ABID97_RS23920 COX15/CtaA family protein (Variovorax sp. OAS795)
MIDTGSLYDLRPIAWLMAAGVLIALGPLVWVWRRNAGAGPARRLHALTVLTLFLTFDLTL
FGAFTRLTDSGLGCPDWPGCYGNASPVGARHEIATAQAAQPTGPVTHGKAWVEMVHRYLA
TGVGVLILVLAAATWVVRWRRRRQPAPEGEHATLSAWWPAATLVWVCLQGAFGALTVTWT
LFPAIVTMHLLGAMVLLVLLCIQAVRYRQAAADRLPAAVSPSLRNGLLATSALLLLQIGL
GGWVSTNYAVLACTQFPTCQGSWWPPMNFAQGFEIWRHLGVTGGGAPLDFSALTAIHYVH
RLMAYAVFAALGLLAWQLRRIPPLRPQARWLAGLALLQLATGLGNVLLGWPLAAAVLHTG
GAAALAVVLTWAVCESRRGAAAAATALDSGKAPGAPHNNNQREAAA