Protein Info for ABID97_RS23915 in Variovorax sp. OAS795

Annotation: heme o synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 transmembrane" amino acids 27 to 49 (23 residues), see Phobius details amino acids 55 to 76 (22 residues), see Phobius details amino acids 97 to 119 (23 residues), see Phobius details amino acids 125 to 144 (20 residues), see Phobius details amino acids 151 to 172 (22 residues), see Phobius details amino acids 178 to 199 (22 residues), see Phobius details amino acids 220 to 242 (23 residues), see Phobius details amino acids 247 to 268 (22 residues), see Phobius details amino acids 280 to 300 (21 residues), see Phobius details TIGR01473: protoheme IX farnesyltransferase" amino acids 18 to 298 (281 residues), 318.3 bits, see alignment E=2.9e-99 PF01040: UbiA" amino acids 32 to 284 (253 residues), 234.8 bits, see alignment E=4.9e-74

Best Hits

Swiss-Prot: 85% identical to COXX_RHOFT: Protoheme IX farnesyltransferase (ctaB) from Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)

KEGG orthology group: K02301, protoheme IX farnesyltransferase [EC: 2.5.1.-] (inferred from 98% identity to vap:Vapar_4382)

MetaCyc: 38% identical to heme O synthase (Escherichia coli K-12 substr. MG1655)
HEMEOSYN-RXN [EC: 2.5.1.141]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.-

Use Curated BLAST to search for 2.5.1.- or 2.5.1.141

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (301 amino acids)

>ABID97_RS23915 heme o synthase (Variovorax sp. OAS795)
MSTPISVQQTSTANVLRQFYALTKPRVVQLIVFCALIGMVLAVPGLPSWADVQRAVLACI
GIWLVAGAAAAFNCLVEKGIDAKMKRTAWRPTARGQLSDLQALVFSALLCAAGSALLWFQ
VNPLTMWLTFATFVGYAVVYTVILKPLTPQNIVIGGASGAMPPVLGWAAMTGDVSPEALI
LFLIIFLWTPPHFWALALYRVEDYRKAGLPMLPVTHGNEFTRLQVLLYTFILFAACLMPF
IYGMSGWLYLAVAVGVSVGFTGYAFALWRNYSDTLARKTFKFSLIHLSVLFAALLVDHYL
R