Protein Info for ABID97_RS23910 in Variovorax sp. OAS795

Annotation: SCO family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF08534: Redoxin" amino acids 48 to 203 (156 residues), 32 bits, see alignment E=1.5e-11 PF00578: AhpC-TSA" amino acids 49 to 184 (136 residues), 46.2 bits, see alignment E=6.2e-16 PF02630: SCO1-SenC" amino acids 51 to 184 (134 residues), 154.6 bits, see alignment E=2.2e-49

Best Hits

Swiss-Prot: 32% identical to SCO22_RICBR: SCO2-like protein RBE_0699 (RBE_0699) from Rickettsia bellii (strain RML369-C)

KEGG orthology group: K07152, (no description) (inferred from 91% identity to vap:Vapar_4381)

Predicted SEED Role

"Cytochrome oxidase biogenesis protein Sco1/SenC/PrrC, putative copper metallochaperone" in subsystem Biogenesis of cytochrome c oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (207 amino acids)

>ABID97_RS23910 SCO family protein (Variovorax sp. OAS795)
MPASMNKRNALQLMAGGAAWAGIAATLGLSGCSEPKPSFNAVDITGADYARDFSLKDADG
KVRTMADFKGKVVVLFFGYAQCPDVCPTTMTEMAQVKQQLGSDGDKLQVLFVTVDPARDT
PEVLKAYMGAFDPGFVALIPTPEQLATIAKDFKVYFKKVEGKTPTSYSMDHSAASFVYDT
SGRVRLYARYGAGVAPMVSDVKALLKA