Protein Info for ABID97_RS23870 in Variovorax sp. OAS795

Annotation: LysE/ArgO family amino acid transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 transmembrane" amino acids 6 to 31 (26 residues), see Phobius details amino acids 43 to 66 (24 residues), see Phobius details amino acids 72 to 93 (22 residues), see Phobius details amino acids 114 to 132 (19 residues), see Phobius details amino acids 152 to 175 (24 residues), see Phobius details amino acids 187 to 208 (22 residues), see Phobius details PF01810: LysE" amino acids 19 to 205 (187 residues), 96.5 bits, see alignment E=7.3e-32

Best Hits

Swiss-Prot: 43% identical to YGGA_AERSA: Putative amino-acid transporter YggA (yggA) from Aeromonas salmonicida

KEGG orthology group: K06895, L-lysine exporter family protein LysE/ArgO (inferred from 90% identity to vap:Vapar_4370)

MetaCyc: 36% identical to L-arginine exporter (Escherichia coli K-12 substr. MG1655)
RXN66-448; TRANS-RXN-325

Predicted SEED Role

"Transporter, LysE family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (211 amino acids)

>ABID97_RS23870 LysE/ArgO family amino acid transporter (Variovorax sp. OAS795)
MAYEQITAAFINGLFMSLVLIVAIGAQNAYVLRQGLRREHVSAVVLFCAASDAVLIAAGV
AGMAQALQGRPAFATALAGLGALFLGAYGLRALWRSRRAGTLQAAAQGASLSRAAVLAQA
AGFTLLNPHVYLDTVLLVGSTGAQYGGSLKGWFVAGSALASALWFSALGFGARWLAPVFA
RPRAWRMLDALIGGTMLVLAALLARRALLGA