Protein Info for ABID97_RS23725 in Variovorax sp. OAS795

Annotation: bifunctional DNA-formamidopyrimidine glycosylase/DNA-(apurinic or apyrimidinic site) lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 TIGR00577: DNA-formamidopyrimidine glycosylase" amino acids 1 to 269 (269 residues), 272.1 bits, see alignment E=2.5e-85 PF01149: Fapy_DNA_glyco" amino acids 1 to 112 (112 residues), 108.5 bits, see alignment E=4.8e-35 PF06831: H2TH" amino acids 130 to 221 (92 residues), 88.7 bits, see alignment E=3e-29 PF06827: zf-FPG_IleRS" amino acids 242 to 270 (29 residues), 39.9 bits, see alignment (E = 4.5e-14)

Best Hits

Swiss-Prot: 97% identical to FPG_VARPS: Formamidopyrimidine-DNA glycosylase (mutM) from Variovorax paradoxus (strain S110)

KEGG orthology group: K10563, formamidopyrimidine-DNA glycosylase [EC: 3.2.2.23 4.2.99.18] (inferred from 97% identity to vap:Vapar_4341)

Predicted SEED Role

"Formamidopyrimidine-DNA glycosylase (EC 3.2.2.23)" in subsystem DNA Repair Base Excision (EC 3.2.2.23)

Isozymes

Compare fitness of predicted isozymes for: 4.2.99.18

Use Curated BLAST to search for 3.2.2.23 or 4.2.99.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (270 amino acids)

>ABID97_RS23725 bifunctional DNA-formamidopyrimidine glycosylase/DNA-(apurinic or apyrimidinic site) lyase (Variovorax sp. OAS795)
MPELPEVEVTRRGFAERIAGARIDAVRIGKPLRWALMVAPEALVGRRVLQVRRRGKYLLI
DLDRGLLLLHLGMSGSLRFDMALPAPGVHDHFDLVTDRGTLRLNDPRRFGAVVYVEDEAA
PWAIKLLGGLGMEPLGDAFDLDAFHAGLRKRRTAVKQVLLAGDVVVGVGNIYASEALFQA
GIRPTLSAARISRPRAARLHAAVREILARAVEKGGSTLRDFSNVDGQNGYFQLEATVYGR
AGEPCRVCATPIRLLRQGQRSTYYCPNCQK