Protein Info for ABID97_RS23550 in Variovorax sp. OAS795

Annotation: urease accessory UreF family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF01730: UreF" amino acids 39 to 181 (143 residues), 135.6 bits, see alignment E=8.5e-44

Best Hits

Swiss-Prot: 70% identical to UREF_ACIAC: Urease accessory protein UreF (ureF) from Acidovorax citrulli (strain AAC00-1)

KEGG orthology group: K03188, urease accessory protein (inferred from 91% identity to vpe:Varpa_4862)

Predicted SEED Role

"Urease accessory protein UreF" in subsystem Urea decomposition

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (223 amino acids)

>ABID97_RS23550 urease accessory UreF family protein (Variovorax sp. OAS795)
MPDAHSLLQLIWLASPALPVGGFSYSEGVEAAVEWAGIDSESKAIEWLSDQLHLGFARGD
LALVAQAIPAWRAGDAERIRALNQWVLATRESAEFFLQTEQMGRSFVEWLKLHHTDTAEV
FADLPASYPVAFAFALSRTGATTTDGCLAFAFGWAENMVAAAVKAVPLGQSAGQRILARL
ANEIPAAVERAMALGDDERQAFAPLLAVLSARHETQYSRLFRS