Protein Info for ABID97_RS23440 in Variovorax sp. OAS795

Annotation: A24 family peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 transmembrane" amino acids 7 to 28 (22 residues), see Phobius details amino acids 132 to 150 (19 residues), see Phobius details amino acids 156 to 175 (20 residues), see Phobius details amino acids 187 to 216 (30 residues), see Phobius details amino acids 250 to 274 (25 residues), see Phobius details amino acids 284 to 305 (22 residues), see Phobius details PF06750: A24_N_bact" amino acids 14 to 150 (137 residues), 113.6 bits, see alignment E=3.6e-37 PF01478: Peptidase_A24" amino acids 161 to 270 (110 residues), 88.9 bits, see alignment E=2.9e-29

Best Hits

KEGG orthology group: K02654, leader peptidase (prepilin peptidase) / N-methyltransferase [EC: 2.1.1.- 3.4.23.43] (inferred from 92% identity to vap:Vapar_4222)

Predicted SEED Role

"Leader peptidase (Prepilin peptidase) (EC 3.4.23.43) / N-methyltransferase (EC 2.1.1.-)" in subsystem Type IV pilus (EC 2.1.1.-, EC 3.4.23.43)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-, 3.4.23.43

Use Curated BLAST to search for 2.1.1.- or 3.4.23.43

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (321 amino acids)

>ABID97_RS23440 A24 family peptidase (Variovorax sp. OAS795)
MLVSQEIDAAFAGVLGLLVGSFLNVVIYRTPVMMYREWLGDAVANLMSSKDMPSLWSLVF
GAKTAPPQGLEAAADKAALAIEGLPPFDLARPASRCGACGHKIRWYENIPVLSYLFLRGR
CGACKTSISLRYPLVELITGALFALCAYRFGVTPTAALWAAFAALLICQFLIDFDTQFLP
DALNYPLLWLGLVGAAMGWTGVALSSAVWGAVFGYLSLWLVYHGYRLVTGKEGMGHGDFK
LLAALGAWLGADYLIAIILVSSLVGAVIGLTLRLIGKLAHKDIPMAFGPFLAGAGLVCLV
ASPELVRQWIPFAFPLGAFAR