Protein Info for ABID97_RS23435 in Variovorax sp. OAS795

Annotation: type II secretion system F family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 transmembrane" amino acids 175 to 199 (25 residues), see Phobius details amino acids 226 to 247 (22 residues), see Phobius details amino acids 381 to 402 (22 residues), see Phobius details PF28597: T2SSF_N" amino acids 17 to 57 (41 residues), 43.9 bits, see alignment 1.6e-15 PF00482: T2SSF" amino acids 75 to 198 (124 residues), 122.7 bits, see alignment E=9.1e-40 amino acids 279 to 401 (123 residues), 107.9 bits, see alignment E=3.7e-35

Best Hits

Swiss-Prot: 50% identical to TAPC_AERHY: Type IV pilus assembly protein TapC (tapC) from Aeromonas hydrophila

KEGG orthology group: K02653, type IV pilus assembly protein PilC (inferred from 98% identity to vap:Vapar_4221)

Predicted SEED Role

"Type IV fimbrial assembly protein PilC" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (409 amino acids)

>ABID97_RS23435 type II secretion system F family protein (Variovorax sp. OAS795)
MATVASTRGSNTLKEFVYEWEGKDRNGKLVRGELRAAGENQVQAALRRQGVLASKVKKRR
MRSGKSIKPKDIAIFTRQLATMMKAGVPLLQSFDIVGRGNANPSVAKLLNDIRSDVETGT
SLSAAFRKFPKYFDNLYCNLVEAGEAAGILEDLLDRLATYMEKTEAIKSKIKSALMYPTS
VVVVAFVVVAVIMIFVIPAFKQVFTSFGADLPAPTLFVMAMSEFFVSYWWLIFGVIGGGS
YFFLQAWKRNERVQRFMDRALLRVPIFGTLIEKSCVARWTRTLATMFAAGVPLVEALDSV
GGASGNTVYSDATAKIQQEVSTGTSLTTAMTNVNLFPSMVIQMTAIGEESGSIDHMLGKA
ADFYESEVDDMVAGLSSLMEPIIIVFLGVIIGGIVVSMYLPIFKLGQVV