Protein Info for ABID97_RS23430 in Variovorax sp. OAS795

Annotation: type IV-A pilus assembly ATPase PilB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 578 TIGR02538: type IV-A pilus assembly ATPase PilB" amino acids 18 to 577 (560 residues), 795.7 bits, see alignment E=1.3e-243 PF05157: MshEN" amino acids 53 to 152 (100 residues), 74.8 bits, see alignment E=5.9e-25 PF00437: T2SSE" amino acids 201 to 468 (268 residues), 345.5 bits, see alignment E=1.8e-107

Best Hits

KEGG orthology group: K02652, type IV pilus assembly protein PilB (inferred from 97% identity to vap:Vapar_4220)

Predicted SEED Role

"Type IV fimbrial assembly, ATPase PilB" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (578 amino acids)

>ABID97_RS23430 type IV-A pilus assembly ATPase PilB (Variovorax sp. OAS795)
MAAAELPVKENTQIALPGLARALVSAGKLPAKAAEDIYQKSLSGRTSFIAELTGSGAVSA
ADLAHTLSSAFGAPLLDLDAIDHQRLPKDLLDPKLCQAYRIVVLSKRNNRLIVATADPSD
QQAVEKIKFASQMGVDWVIAEYDKLSRMIEAAAVTASESLNSIVGTVEFEFDDVAADTSG
DANEQAIAEVDDAPVVRFLHKMLLDGVSMRASDIHFEPYEHNYRVRFRIDGELREIASPP
TLIKDKLASRIKVISRLDISEKRVPQDGRMKLKIGPDRVIDFRVSTLPTLFGEKIVIRIL
DPSSARLGIDALGYDADEKERLLNAIGRPYGMVLVTGPTGSGKTVSLYTCLNLLNQPGVN
IATAEDPSEINLPGVNQVNVNERAGLTFATALRAFLRQDPDIIMVGEIRDLETADISIKA
AQTGHLVLSTLHTNDAPTTLTRMRNMGIAPFNIASSVILITAQRLARRLCHACRAPADVP
RQALLDAGFKEAELNGTWKPYRPVGCAACNGGYKGRVGIYQVMPISEAIQAIILRDGSAL
DIARQSEAEGVRSLRQSGLRKVMQGLTSLEEVVAVTNE