Protein Info for ABID97_RS23355 in Variovorax sp. OAS795

Annotation: methionine adenosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 PF00438: S-AdoMet_synt_N" amino acids 5 to 101 (97 residues), 140 bits, see alignment E=4.8e-45 TIGR01034: methionine adenosyltransferase" amino acids 6 to 390 (385 residues), 590 bits, see alignment E=9.3e-182 PF02772: S-AdoMet_synt_M" amino acids 118 to 239 (122 residues), 158.9 bits, see alignment E=8.9e-51 PF02773: S-AdoMet_synt_C" amino acids 241 to 379 (139 residues), 224.9 bits, see alignment E=4.6e-71

Best Hits

Swiss-Prot: 98% identical to METK_VARPS: S-adenosylmethionine synthase (metK) from Variovorax paradoxus (strain S110)

KEGG orthology group: K00789, S-adenosylmethionine synthetase [EC: 2.5.1.6] (inferred from 98% identity to vpe:Varpa_1212)

MetaCyc: 68% identical to methionine adenosyltransferase (Escherichia coli K-12 substr. MG1655)
Methionine adenosyltransferase. [EC: 2.5.1.6]

Predicted SEED Role

"S-adenosylmethionine synthetase (EC 2.5.1.6)" in subsystem Methionine Biosynthesis or Methionine Degradation or Quorum Sensing: Autoinducer-2 Synthesis (EC 2.5.1.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (393 amino acids)

>ABID97_RS23355 methionine adenosyltransferase (Variovorax sp. OAS795)
MANDFLFTSESVSEGHPDKVADQISDAILDAIFEQDPRSRVAAETLTNTGLVVLAGEITT
NAHVDYIQVARDTIKRIGYDNTDYGIDYKGCAVMVCYDKQSNDIAQGVDHASDDHLNTGA
GDQGLMFGYACDETPELMPAPIYYAHRLVERQAQLRKDGRLPFLRPDAKSQVTMRYVDGK
PHSIDTVVLSTQHSPDQSETSTKMKASFNEAIIEEIIKPVLPKEWLQNTRYLINPTGRFV
IGGPQGDCGLTGRKIIVDTYGGACPHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLA
RQCQIQVAYAIGVAQPMNITVYTEGTGVIPDDKLAELVREFFDLRPKGIIQMLDLLRPIY
QKTAAYGHFGREEPEFTWEATTQAAALRAAAGL