Protein Info for ABID97_RS23355 in Variovorax sp. OAS795

Annotation: methionine adenosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00438: S-AdoMet_synt_N
  • amino acids 5 to 101 (97 residues), 139.5 bits, E=6.7e-45
• TIGR01034: methionine adenosyltransferase
  • amino acids 6 to 390 (385 residues), 590 bits, E=9.3e-182
• PF02772: S-AdoMet_synt_M
  • amino acids 118 to 239 (122 residues), 159.2 bits, E=7.1e-51
• PF02773: S-AdoMet_synt_C
  • amino acids 241 to 379 (139 residues), 225.3 bits, E=3.4e-71

Best Hits

Swiss-Prot: 98% identical to METK_VARPS: S-adenosylmethionine synthase (metK) from Variovorax paradoxus (strain S110)

KEGG orthology group: K00789, S-adenosylmethionine synthetase [EC: 2.5.1.6] (inferred from 98% identity to vpe:Varpa_1212)

MetaCyc: 68% identical to methionine adenosyltransferase (Escherichia coli K-12 substr. MG1655)
Methionine adenosyltransferase. [EC: 2.5.1.6]

Predicted SEED Role

"S-adenosylmethionine synthetase (EC 2.5.1.6)" in subsystem Methionine Biosynthesis or Methionine Degradation or Quorum Sensing: Autoinducer-2 Synthesis (EC 2.5.1.6)

MetaCyc Pathways

• aspartate superpathway (24/25 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (8/9 steps found)
• S-adenosyl-L-methionine salvage II (3/3 steps found)
• S-adenosyl-L-methionine biosynthesis (1/1 steps found)
• S-adenosyl-L-methionine salvage I (3/4 steps found)
• L-methionine degradation I (to L-homocysteine) (2/3 steps found)
• ethene biosynthesis I (plants) (1/3 steps found)
• superpathway of L-cysteine biosynthesis (mammalian) (2/5 steps found)
• 2'-deoxymugineic acid phytosiderophore biosynthesis (1/4 steps found)
• L-cysteine biosynthesis VI (reverse transsulfuration) (3/7 steps found)
• superpathway of L-methionine salvage and degradation (8/16 steps found)
• L-methionine salvage cycle I (bacteria and plants) (5/12 steps found)
• L-methionine salvage cycle II (plants) (3/11 steps found)
• L-methionine salvage cycle III (3/11 steps found)

KEGG Metabolic Maps

• Biosynthesis of plant hormones
• Methionine metabolism
• Selenoamino acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.6

Protein Sequence (393 amino acids)

>ABID97_RS23355 methionine adenosyltransferase (Variovorax sp. OAS795)
MANDFLFTSESVSEGHPDKVADQISDAILDAIFEQDPRSRVAAETLTNTGLVVLAGEITT
NAHVDYIQVARDTIKRIGYDNTDYGIDYKGCAVMVCYDKQSNDIAQGVDHASDDHLNTGA
GDQGLMFGYACDETPELMPAPIYYAHRLVERQAQLRKDGRLPFLRPDAKSQVTMRYVDGK
PHSIDTVVLSTQHSPDQSETSTKMKASFNEAIIEEIIKPVLPKEWLQNTRYLINPTGRFV
IGGPQGDCGLTGRKIIVDTYGGACPHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLA
RQCQIQVAYAIGVAQPMNITVYTEGTGVIPDDKLAELVREFFDLRPKGIIQMLDLLRPIY
QKTAAYGHFGREEPEFTWEATTQAAALRAAAGL