Protein Info for ABID97_RS23310 in Variovorax sp. OAS795

Annotation: protein-methionine-sulfoxide reductase heme-binding subunit MsrQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 49 to 66 (18 residues), see Phobius details amino acids 78 to 97 (20 residues), see Phobius details amino acids 115 to 134 (20 residues), see Phobius details amino acids 150 to 168 (19 residues), see Phobius details amino acids 174 to 193 (20 residues), see Phobius details PF01794: Ferric_reduct" amino acids 53 to 157 (105 residues), 61.4 bits, see alignment E=4.4e-21

Best Hits

Swiss-Prot: 84% identical to MSRQ_POLNA: Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ (msrQ) from Polaromonas naphthalenivorans (strain CJ2)

KEGG orthology group: None (inferred from 94% identity to vap:Vapar_1135)

Predicted SEED Role

"FIG001196: Membrane protein YedZ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (219 amino acids)

>ABID97_RS23310 protein-methionine-sulfoxide reductase heme-binding subunit MsrQ (Variovorax sp. OAS795)
MNKLLMHPAAKPVIFLLCLLPFARLTYGAFTDGLGANPAEFLIRATGDWTLRFICIVLAV
TPLRVITKANALARFRRMLGLFAYFYVVLHLLCYSWFDMGFEWADIAKDIAKRPFILVGF
SAFVLLTPLAATSFNRAIKAMGARRWQMLHKLVYLISGLGLLHFFWMRAGKNNFAEVFVY
AAIIAVLLGWRVWNHASKRKPKAPAGVRGNSEKPLRSAG