Protein Info for ABID97_RS23100 in Variovorax sp. OAS795

Annotation: phosphoribosyl-AMP cyclohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 129 PF01502: PRA-CH" amino acids 29 to 106 (78 residues), 116.8 bits, see alignment E=1.6e-38

Best Hits

Swiss-Prot: 85% identical to HIS3_DELAS: Phosphoribosyl-AMP cyclohydrolase (hisI) from Delftia acidovorans (strain DSM 14801 / SPH-1)

KEGG orthology group: K01496, phosphoribosyl-AMP cyclohydrolase [EC: 3.5.4.19] (inferred from 97% identity to vap:Vapar_1176)

Predicted SEED Role

"Phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19)" in subsystem Histidine Biosynthesis (EC 3.5.4.19)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (129 amino acids)

>ABID97_RS23100 phosphoribosyl-AMP cyclohydrolase (Variovorax sp. OAS795)
MNWLDEVKWDAAGLVPVIAQEQGSNDVLMFAWMNREALEKTAELGRAVYFSRSRNKLWFK
GEESGHVQTVHEIRLDCDNDVVLLKVTQLGHEPGIACHTGRHSCFFSKYANGQWTAVEPV
LKDPESIYK