Protein Info for ABID97_RS23050 in Variovorax sp. OAS795

Annotation: large conductance mechanosensitive channel protein MscL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 143 transmembrane" amino acids 15 to 61 (47 residues), see Phobius details amino acids 83 to 106 (24 residues), see Phobius details TIGR00220: large conductance mechanosensitive channel protein" amino acids 3 to 141 (139 residues), 138.6 bits, see alignment E=6.5e-45 PF01741: MscL" amino acids 4 to 141 (138 residues), 152.7 bits, see alignment E=2.9e-49

Best Hits

Swiss-Prot: 92% identical to MSCL_VARPS: Large-conductance mechanosensitive channel (mscL) from Variovorax paradoxus (strain S110)

KEGG orthology group: K03282, large conductance mechanosensitive channel (inferred from 92% identity to vap:Vapar_1187)

Predicted SEED Role

"Large-conductance mechanosensitive channel" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (143 amino acids)

>ABID97_RS23050 large conductance mechanosensitive channel protein MscL (Variovorax sp. OAS795)
MSIISEFKEFAIKGNVVDLAVGVIIGAAFGKIVDSLVADIIMPIVGLVFGKLDFSNLYVV
LGSVPAGVPGNLADLKKAGVPVLAYGNFITIAVNFVILAFIIFMMVKQINKLRRRHADAP
AAPVAPPEDIALLREIRDSLKRP