Protein Info for ABID97_RS23005 in Variovorax sp. OAS795

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 43 to 63 (21 residues), see Phobius details amino acids 75 to 99 (25 residues), see Phobius details amino acids 105 to 122 (18 residues), see Phobius details amino acids 133 to 153 (21 residues), see Phobius details amino acids 163 to 188 (26 residues), see Phobius details amino acids 209 to 229 (21 residues), see Phobius details amino acids 241 to 261 (21 residues), see Phobius details amino acids 280 to 302 (23 residues), see Phobius details amino acids 321 to 339 (19 residues), see Phobius details amino acids 347 to 366 (20 residues), see Phobius details amino acids 373 to 398 (26 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 84% identity to vap:Vapar_1196)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (408 amino acids)

>ABID97_RS23005 hypothetical protein (Variovorax sp. OAS795)
MASGIRKRLGGPILAVADQCIYSASQLLLSFALARALSPSDFGIASAFLAIASFQYILHT
AVVHEPLLIRRHYANLAAVWWSWALVLAVSLAGFLAWQFTSFPGPASWAGVALIVGYEIF
WLSRSVLLVGRRYLVLCISGVAIGIGYVAVLIGAKPATWTQALLWIAVIQLPFAVLIAGS
LTGVIAPLPAPADSQALTVREAASYGWKASLSQLMSWIMTGGAILLLGSSADSAQGGLLK
IYITFLLPMQYVLLALGYYILPRLAAGWNTDRRGEAFRLFIQFALFGFVVAEIGGVLLGL
LGPQLVVLAFGRNYGGMDFSPFFYAPAIFGLTMCLRTGFRAAARPGALLWCSAFGALVFA
AGMIVAKPPISYIHTINAMTLGFACMAVMMIGWLFVIMRGAGAAAPAR