Protein Info for ABID97_RS22980 in Variovorax sp. OAS795

Annotation: cytochrome bc complex cytochrome b subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 478 transmembrane" amino acids 46 to 71 (26 residues), see Phobius details amino acids 93 to 117 (25 residues), see Phobius details amino acids 130 to 152 (23 residues), see Phobius details amino acids 159 to 183 (25 residues), see Phobius details amino acids 197 to 219 (23 residues), see Phobius details amino acids 256 to 276 (21 residues), see Phobius details amino acids 320 to 337 (18 residues), see Phobius details amino acids 344 to 361 (18 residues), see Phobius details amino acids 367 to 386 (20 residues), see Phobius details amino acids 403 to 426 (24 residues), see Phobius details amino acids 434 to 460 (27 residues), see Phobius details PF00033: Cytochrome_B" amino acids 38 to 224 (187 residues), 226 bits, see alignment E=5.5e-71 PF13631: Cytochrom_B_N_2" amino acids 106 to 277 (172 residues), 147.3 bits, see alignment E=6.7e-47 PF00032: Cytochrom_B_C" amino acids 290 to 344 (55 residues), 47.9 bits, see alignment 2.1e-16 amino acids 359 to 424 (66 residues), 63.4 bits, see alignment E=3.1e-21

Best Hits

KEGG orthology group: K00412, ubiquinol-cytochrome c reductase cytochrome b subunit [EC: 1.10.2.2] (inferred from 97% identity to vpe:Varpa_1280)

Predicted SEED Role

"Ubiquinol--cytochrome c reductase, cytochrome B subunit (EC 1.10.2.2)" in subsystem Ubiquinone Menaquinone-cytochrome c reductase complexes (EC 1.10.2.2)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.10.2.2

Use Curated BLAST to search for 1.10.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (478 amino acids)

>ABID97_RS22980 cytochrome bc complex cytochrome b subunit (Variovorax sp. OAS795)
MAEFHEISPNAPAGEKLLNWVDNRFPLTKLWNDQWGKYYAPKNFNFWYIFGSLAMLVLVI
QIVTGIFLVMHYKPDANQAFASVEYIMRDVPWGWLIRYIHSTGASAFFIVVYLHMFRGLM
YGSYRKPRELIWVFGCAIFLCLMAEAFMGYLLPWGQMSYWGAQVIVNLFAAIPFVGPDLA
LLIRGDYVVSDATLNRFFSFHVIAVPLVLLGLVVAHLIALHEVGSNNPDGIEIKANRGPD
GHPLDGIPSHPYYTVHDIFGVVVFLTIFSAVIFFAPEAGGYFLEYNNFIPADSLKTPNHI
APVWYFTPFYSMLRATTDDMVNVFALIIGLAAVLNFVKGRSSTALKIALVVVAAVAIFLL
KAFDAKFWGVVVMGGSVIILFFLPWLDHSEVKSIRYRPSWHKYVYGVFVFFFLILGYLGI
QAPGVWGNLVIGSFVLDIAQTISQIGTLFYFGFFLLMPWWSSKGEFKTVPDRVTFAAH