Protein Info for ABID97_RS22880 in Variovorax sp. OAS795

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 signal peptide" amino acids 1 to 38 (38 residues), see Phobius details transmembrane" amino acids 78 to 104 (27 residues), see Phobius details amino acids 124 to 149 (26 residues), see Phobius details amino acids 156 to 176 (21 residues), see Phobius details amino acids 196 to 221 (26 residues), see Phobius details amino acids 241 to 263 (23 residues), see Phobius details PF12911: OppC_N" amino acids 5 to 53 (49 residues), 32 bits, see alignment 9.4e-12 PF00528: BPD_transp_1" amino acids 94 to 277 (184 residues), 105.7 bits, see alignment E=2.6e-34

Best Hits

Swiss-Prot: 49% identical to Y1093_BRUSU: Putative peptide transport system permease protein BRA1093/BS1330_II1085 (BRA1093) from Brucella suis biovar 1 (strain 1330)

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 99% identity to vap:Vapar_1216)

MetaCyc: 34% identical to murein tripeptide ABC transporter / oligopeptide ABC transporter inner membrane subunit OppC (Escherichia coli K-12 substr. MG1655)
3.6.3.23-RXN [EC: 7.4.2.6]; 7.4.2.6 [EC: 7.4.2.6]

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (279 amino acids)

>ABID97_RS22880 ABC transporter permease (Variovorax sp. OAS795)
MPMPRMLRQLMHRRIVMVSALVLLVIAVLAIGAPLFASIDPNDTAVLQRLKGPSAEHLLG
TDELGRDMYSRIVHGARYSLAIAALTALGSVIAGTVLGLMAGFFRRLDTPLMRVVDAMMS
FPDILLAIALVAILGPSLINTVLALVLVYTPRVARVVRASTLVVRELLFVEAVRALGVRT
SRILWRHILPNLMSPILVQVSFIFAYAILAEAGLSFLGVGVPPEIPTWGTMVAGSQQYAH
QAFWVVLFPGLAIIFTALSLQLLGDGVRDLLDPKLKKTL