Protein Info for ABID97_RS22860 in Variovorax sp. OAS795

Annotation: MurR/RpiR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 PF01418: HTH_6" amino acids 5 to 77 (73 residues), 55.4 bits, see alignment E=5.1e-19 PF01380: SIS" amino acids 127 to 255 (129 residues), 28.8 bits, see alignment E=9.6e-11

Best Hits

Swiss-Prot: 30% identical to Y211_CALS4: Uncharacterized HTH-type transcriptional regulator TTE0211 (TTE0211) from Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)

KEGG orthology group: None (inferred from 97% identity to vap:Vapar_1220)

Predicted SEED Role

"Probable transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (303 amino acids)

>ABID97_RS22860 MurR/RpiR family transcriptional regulator (Variovorax sp. OAS795)
MTPSLLQKIAGLRSSAPATRRAILDLILEDPDRALEESFEQLAERSRSSVPTIMRTCRDL
GFAGLREFKLALAQELALGGSPLHRRVNIEDAADEVVGKIARSAAASVSGVRGQLDMQVL
EGAVAAIAAAPHVDLYGAGATSWFMANDLQARLFRLGLSANAWTDYHLQQVAGAAQRPGG
VVIAISHVGGMPSLLDAVDIARGQGAKVVALTRPGTALAARADFLLGLSVPDDAVMHVGI
DAYLTHLTAIEILTVLVAQRRGEPAVQRLQRAREAFQRHGIDASTHPLQSWDGGGIDSKG
RAS