Protein Info for ABID97_RS22745 in Variovorax sp. OAS795

Annotation: VWA domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 59 to 81 (23 residues), see Phobius details amino acids 319 to 341 (23 residues), see Phobius details PF07584: BatA" amino acids 1 to 75 (75 residues), 40.1 bits, see alignment E=6e-14 PF13519: VWA_2" amino acids 88 to 176 (89 residues), 59.3 bits, see alignment E=8.2e-20 PF00092: VWA" amino acids 88 to 177 (90 residues), 26.3 bits, see alignment E=1.2e-09 amino acids 219 to 301 (83 residues), 28.3 bits, see alignment E=2.9e-10

Best Hits

KEGG orthology group: K07114, uncharacterized protein (inferred from 98% identity to vap:Vapar_1241)

Predicted SEED Role

"BatA (Bacteroides aerotolerance operon)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (345 amino acids)

>ABID97_RS22745 VWA domain-containing protein (Variovorax sp. OAS795)
MTFLWPQFLWLLAALPLLVLLYIWLIRRKKKLAVRYASLSIVREAMGAGQSIRRHIPPFL
FLLAMAAMLVAAARPMAVVMLPSNQQTIILAMDVSGSMRAADVLPNRLVAAQEAAKTFIK
DLPRHVKVGIVAFAGSAQVAQLPTTNHDDLVTAIDSFQLQRATATGNAIVVSLATLFPDA
GIDVSQFSAPSRQRGTPIDQTEKQAKEFTPVAPGSYTSAAIIMLTDGQRTTGVDPLDAAK
AAADRGVRIYTVGVGTVDGETIGFEGWSMRVRLDEETLKAVANKTQAEYFYAGTAADLKK
VYETLSSRLTVEKKETEISALFALGAAILTLLSAGLSLLWFNRIL