Protein Info for ABID97_RS22600 in Variovorax sp. OAS795

Annotation: DMT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 transmembrane" amino acids 35 to 53 (19 residues), see Phobius details amino acids 64 to 85 (22 residues), see Phobius details amino acids 104 to 121 (18 residues), see Phobius details amino acids 127 to 146 (20 residues), see Phobius details amino acids 153 to 169 (17 residues), see Phobius details amino acids 175 to 197 (23 residues), see Phobius details amino acids 209 to 229 (21 residues), see Phobius details amino acids 235 to 258 (24 residues), see Phobius details amino acids 270 to 287 (18 residues), see Phobius details amino acids 293 to 313 (21 residues), see Phobius details PF00892: EamA" amino acids 37 to 169 (133 residues), 33.9 bits, see alignment E=1.9e-12 amino acids 178 to 302 (125 residues), 28.7 bits, see alignment E=7.6e-11

Best Hits

KEGG orthology group: None (inferred from 96% identity to vap:Vapar_4022)

Predicted SEED Role

"Membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (325 amino acids)

>ABID97_RS22600 DMT family transporter (Variovorax sp. OAS795)
MSQSPGPGTDSAATAALANARAASRQARDAESGRILAGIGLVLVAVACFATLDTATKTST
AAVPILMGVWFRYAFQAVATTAVLLPRHGTALLRTQHPRYQLLRGALLLVSSTLAFLSLR
YMPLAEFTSIVLIAPLVITLLAATTLKEYVSPLRWTLVAGGFIGTLVILRPGGDAFSWAV
LLPVGLVLTNAWFQVLTSKLAQTENPLTMHFYTGWVGALIASLTLPFVWTALPSWHWWAL
LCLMGFMGTVGHFILILAYQRAPASTLTPYLYAQIAFAMLGGWLVFSHVPDRFSLIGMAM
IAVCGAAGAWLTVRERRVPIEPAES