Protein Info for ABID97_RS22585 in Variovorax sp. OAS795

Annotation: polyphosphate kinase 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03707: polyphosphate kinase 2
  • amino acids 51 to 276 (226 residues), 380.3 bits, E=1.8e-118
• PF03976: PPK2
  • amino acids 52 to 276 (225 residues), 364.5 bits, E=1.2e-113

Best Hits

Swiss-Prot: 74% identical to PK21B_PSEAE: Polyphosphate:ADP phosphotransferase (PA2428) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 94% identity to vap:Vapar_4019)

Predicted SEED Role

"UDP-galactose-lipid carrier transferase (EC 2.-.-.-)" (EC 2.-.-.-)

KEGG Metabolic Maps

• Lipopolysaccharide biosynthesis
• Puromycin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.-

Protein Sequence (306 amino acids)

>ABID97_RS22585 polyphosphate kinase 2 (Variovorax sp. OAS795)
MMLTSALPDHEDLMQRIARDLIDSYDEELELEIEDRGIDGLEPAAHPGDKAARQAYFKEL
FRLQGELVKLQDWVQHHKKKVVILFEGRDAAGKGGVIKRITQRLNPRVARVAALPAPNDR
ERTQWYFQRYAAHLPAAGEMVLFDRSWYNRAGVERVMGFCTDDEYEEFFRTVPEFEKMLV
RSGITLIKYWFSITDDEQHMRFLGRIHDPLKQWKLSPMDLESRRRWEEYTKAKETMLERT
HIPEAPWWVVQAVDKKKARLNCISHLLAQLPYQEVPHPPVELPARERHADYLRQPVPAHM
IVPEIH