Protein Info for ABID97_RS22545 in Variovorax sp. OAS795

Annotation: urea ABC transporter ATP-binding subunit UrtE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 TIGR03410: urea ABC transporter, ATP-binding protein UrtE" amino acids 2 to 230 (229 residues), 343.4 bits, see alignment E=2.9e-107 PF00005: ABC_tran" amino acids 17 to 159 (143 residues), 116.5 bits, see alignment E=1.4e-37

Best Hits

KEGG orthology group: K01996, branched-chain amino acid transport system ATP-binding protein (inferred from 97% identity to vpe:Varpa_4647)

Predicted SEED Role

"Urea ABC transporter, ATPase protein UrtE" in subsystem Urea decomposition

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (230 amino acids)

>ABID97_RS22545 urea ABC transporter ATP-binding subunit UrtE (Variovorax sp. OAS795)
MLTVKNIHQYYGGSHILRNVSFEATLGKVTVLLGRNGVGKTTLLKSLMGLVPIKSGSIEL
QGKPIHKATPYERARAGIGFVPQGREIFARLTVEENLRMGLAYKSGSTPVPAELFELFPV
LRQMINRRGGDLSGGQQQQLAIARALAPRPKLLILDEPTEGIQPSIIKDIGRVIRMLADR
GDMAIVLCEQYYDFAQELADDYLVMERGEVIARGLGKDMEAQGVRQLVAI