Protein Info for ABID97_RS22515 in Variovorax sp. OAS795

Annotation: response regulator transcription factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00072: Response_reg
  • amino acids 12 to 123 (112 residues), 91.4 bits, E=4.2e-30
• PF00196: GerE
  • amino acids 150 to 204 (55 residues), 58.7 bits, E=3.5e-20

Best Hits

Swiss-Prot: 34% identical to LIAR_BACSU: Transcriptional regulatory protein LiaR (liaR) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 95% identity to vap:Vapar_3992)

MetaCyc: 32% identical to DNA-binding transcriptional dual regulator NarL (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"DNA-binding response regulator, LuxR family"

Protein Sequence (214 amino acids)

>ABID97_RS22515 response regulator transcription factor (Variovorax sp. OAS795)
MANQHAPPIRLFLVDDHPLVRDGLRARLGAMPNLEIVGEAGSAAEALALVDSLQPDLLLM
DVGMKDMNGIDLAALVLQRQPAPHVVMLSMYDNPEYVQKALQVGARGYVLKDAPAAEIVA
AIEAVSGGGTFLSPAVSKKLFRNQAPRPLLTPRESEILSALGRGESSKQIARDLGLSVRT
VEAHRQSIKRRLGIEGQAELIKYAVEHAREFGRE